PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61250.1
Common NameAtMYB17, LMI2, MYB17, T20K12.150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 299aa    MW: 33289.7 Da    PI: 6.9366
Description myb domain protein 17
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde lv  +k+ G g+W+t ++  g+ R++k+c++rw +yl
      AT3G61250.1 14 KGPWTPEEDEVLVAHIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.54.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
      AT3G61250.1  67 RGPFTADEEKLVIQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.951961IPR017930Myb domain
SuperFamilySSF466893.03E-3011108IPR009057Homeodomain-like
SMARTSM007179.6E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-141461IPR001005SANT/Myb domain
CDDcd001672.67E-101661No hitNo description
PROSITE profilePS5129425.22162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2665116IPR009057Homeodomain-like
SMARTSM007178.4E-1566114IPR001005SANT/Myb domain
PfamPF002495.1E-1567112IPR001005SANT/Myb domain
CDDcd001672.14E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000229anatomyflower meristem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRTPCCDKI GLKKGPWTPE EDEVLVAHIK KNGHGSWRTL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TADEEKLVIQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG  120
LDPRTHEPLP SYGLAKQAPS SPTTRHMAQW ESARVEAEAR LSRESMLFSP SFYSGVVKTE  180
CDHFLRIWNS EIGEAFRNLA PLDESTITSQ SPCSRATSTS SALLKSSTNS WGGKEVTVAI  240
HGSDYSPYSN DLEDDSTDSA LQLLLDFPIS DDDMSFLEEN IDSYSQAPPI GLVSMVSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.9740.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425661080.0
Genevisible251363_at0.0
Expression AtlasAT3G61250-
AtGenExpressAT3G61250-
ATTED-IIAT3G61250-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. LFY and AGL15 are involved in the regulation of AtMYB17 in early inflorescence development and seed germination.
    [PMID: 19232308]
  2. Data show that the direct LEAFY target LATE MERISTEM IDENTITY2 (LMI2) has a role in the meristem identity transition, and acts together with LEAFY to activate APETALA1
    [PMID: 21750030]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G13790 (A), AT5G61850 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G61850
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196010.0AY519601.1 Arabidopsis thaliana MYB transcription factor (At3g61250) mRNA, complete cds.
GenBankBT0331290.0BT033129.1 Arabidopsis thaliana unknown protein (At3g61250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191684.10.0LATE MERISTEM IDENTITY2
TrEMBLQ9M2D90.0Q9M2D9_ARATH; At3g61250
STRINGAT3G61250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. William DA, et al.
    Genomic identification of direct target genes of LEAFY.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(6): p. 1775-80
    [PMID:14736918]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  7. Zhang Y,Cao G,Qu LJ,Gu H
    Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15.
    J Genet Genomics, 2009. 36(2): p. 99-107
    [PMID:19232308]
  8. Pastore JJ, et al.
    LATE MERISTEM IDENTITY2 acts together with LEAFY to activate APETALA1.
    Development, 2011. 138(15): p. 3189-98
    [PMID:21750030]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]